Structure of PDB 6dhb Chain A |
>6dhbA (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] |
MVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDE RDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEK FNLKLVIK |
|
PDB | 6dhb High resolution X-ray and NMR structural study of human T-cell immunoglobulin and mucin domain containing protein-3. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
I92 G94 N97 D98 |
I92 G94 N97 D98 |
|
|
|