Structure of PDB 6dh8 Chain A
Receptor sequence
| >6dh8A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
| PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGV GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
3D structure
| PDB | 6dh8 Structural Adaptation of Darunavir Analogues against Primary Mutations in HIV-1 Protease. | ||
| Chain | A | ||
| Resolution | 1.951 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | D25 T26 G27 |
| Catalytic site (residue number reindexed from 1) | D25 T26 G27 |
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | A60 | A | D25 G27 A28 D29 G48 V50 | D25 G27 A28 D29 G48 V50 | MOAD: Ki=146.2pM PDBbind-CN: -logKd/Ki=9.84,Ki=146.2pM |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0004190 | aspartic-type endopeptidase activity |
