Structure of PDB 6dgx Chain A

Receptor sequence

>6dgxA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 6dgx Structural Adaptation of Darunavir Analogues against Primary Mutations in HIV-1 Protease.
• Chain: A
• Resolution: 2.001 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	A	D25 G27 A28 D29 D30 G48 I50	D25 G27 A28 D29 D30 G48 I50	MOAD: Ki<5pM PDBbind-CN: -logKd/Ki=11.30,Ki<5pM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:6dgx, PDBe:6dgx, PDBj:6dgx
• PDBsum: 6dgx
• PubMed: 30543749
• UniProt: Q72498