Structure of PDB 6dcl Chain A

Receptor sequence

>6dclA (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]

PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG
FGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKK
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH
DSVDKIVIQKYHTVNGHNCEVRKALSKQEMAS

3D structure

PDB

6dcl Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1.

Chain

Resolution

2.497 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K15 F17 G19 G20 R55 F57 F59 E85 A89 V90 R92 S95 H101	K9 F11 G13 G14 R49 F51 F53 E79 A83 V84 R86 S89 H95	PDBbind-CN: Kd=15.5nM
BS02	rna	A	K106 F108 G110 G111 E114 K145 R146 G147 F148 F150 E176 R178 A180 L181 S182 K183 M186	K100 F102 G104 G105 E108 K139 R140 G141 F142 F144 E170 R172 A174 L175 S176 K177 M180	PDBbind-CN: Kd=15.5nM

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6dcl, PDBe:6dcl, PDBj:6dcl
PDBsum	6dcl
PubMed	29946118
UniProt	P09651\|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]