Structure of PDB 6d9b Chain A

Receptor sequence

>6d9bA (length=386) Species: 1717 (Corynebacterium diphtheriae)

SDFDLIVVGSGLFGLTVAERAASQLGKKVLIVEKRSHLGGNAYSEAEPET
GIEIHKYGAHLFHTSNKRVWDYVNQFTAFTGYQHRVFAMHNGTAYQFPMG
LGLINQFFGRYYTPDEARELIKEQSAEIDSKDATNLEEKAISLIGRPLYE
AFIRDYTAKQWQTDPKELPAGNITRLPVRYNFDNRYFNDTYEGLPVDGYA
QWLSNMADHENIEVRLDTDWFEVREDLRAQNPEAPVVYTGPLDRYFDYSE
GHLGWRTLDFETEVLNTGDFQGTPVMNYNDAEFPYTRIHEFRHFHPERED
RHPKDKTVIMKEYSRFAEEGDEPYYPINTPSDREMLFKYRELADAETESG
KVYFGGRLGTYQYLDMHMAIASALSMFDNKLVDALK

3D structure

• PDB: 6d9b Substrate recognition by FAD in UDP-galactopyranose mutase
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	V9 G10 G12 L13 F14 E34 K35 R36 G41 N42 Y58 A60 H61 L62 D220 W221 F222 G241 Y325 Y326 G357 R358 Y364 L365 D366 M367	V8 G9 G11 L12 F13 E33 K34 R35 G40 N41 Y57 A59 H60 L61 D219 W220 F221 G240 Y324 Y325 G356 R357 Y363 L364 D365 M366
BS02	UPG	A	F98 F153 I154 Y157 T158 Q161 Y187 N278 R288 D366	F97 F152 I153 Y156 T157 Q160 Y186 N277 R287 D365

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 18:52:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6d9b', asym_id = 'A', title = 'Substrate recognition by FAD in UDP-galactopyranose mutase'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6d9b', asym_id='A', title='Substrate recognition by FAD in UDP-galactopyranose mutase')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008767', uniprot = '', pdbid = '6d9b', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008767', uniprot='', pdbid='6d9b', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>