Structure of PDB 6d6j Chain A |
>6d6jA (length=112) Species: 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) [Search protein sequence] |
NCLFCKIAQGEIPATVVFEDKNILAFRDIRPQAPTHLLIIPKKHIATIND VNDDDSELLANILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLH LLGGRQMTWPPG |
|
PDB | 6d6j Crystal structure of HIT family hydrolase from Legionella pneumophila Philadelphia 1 |
Chain | A |
Resolution | 1.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C3 C6 H45 H97 |
C2 C5 H44 H96 |
|
|
|
|