Structure of PDB 6cw4 Chain A |
>6cw4A (length=87) Species: 11888 (Rous sarcoma virus - Prague C) [Search protein sequence] |
SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGS WDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE |
|
PDB | 6cw4 Structural basis for targeting avian sarcoma virus Gag polyprotein to the plasma membrane for virus assembly. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FGV |
A |
K6 K13 K23 K24 |
K6 K13 K23 K24 |
PDBbind-CN: -logKd/Ki=2.82,Kd=1.50mM |
|
|