Structure of PDB 6cvo Chain A

Receptor sequence

>6cvoA (length=175) Species: 9606 (Homo sapiens)

GHWSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLK
AVAREHLELLKHMHTVGEKVIVDFAGSSKLRFRLGYHAIPSMSHVHLHVI
SQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLK
LPLRCHECQQLLPSIPQLKEHLRKH

3D structure

• PDB: 6cvo Mechanism of APTX nicked DNA sensing and pleiotropic inactivation in neurodegenerative disease.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.71: adenosine-5'-diphospho-5'-[DNA] diphosphatase.
  3.6.1.72: DNA-3'-diphospho-5'-guanosine diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	W167 Y195 K197 S255 M256 K274 K277 H278	W3 Y31 K33 S91 M92 K110 K113 H114
BS02	dna	A	H166 W167 K276 S328 I329 P330	H2 W3 K112 S164 I165 P166
BS03	AMP	A	L171 D193 K194 Y195 L203 H251 P254 S255 M256 H260 H262	L7 D29 K30 Y31 L39 H87 P90 S91 M92 H96 H98
BS04	ZN	A	C319 C322 H335 H339	C155 C158 H171 H175

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity

External links

• PDB: RCSB:6cvo, PDBe:6cvo, PDBj:6cvo
• PDBsum: 6cvo
• PubMed: 29934293
• UniProt: Q7Z2E3|APTX_HUMAN Aprataxin (Gene Name=APTX)