Structure of PDB 6cve Chain A

Receptor sequence

>6cveA (length=227) Species: 83332 (Mycobacterium tuberculosis H37Rv)

GGTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDD
LAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLD
RPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHT
KLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAG
AASLDAGDFAAMSAAAFDRNWVAGLVG

3D structure

• PDB: 6cve Mycobacterium tuberculosis Dethiobiotin Synthetase Facilitates Nucleoside Triphosphate Promiscuity through Alternate Binding Modes
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T11 G12 K15 T16 K37 T41 G54 E108
• Catalytic site (residue number reindexed from 1): T12 G13 K16 T17 K38 T42 G55 E109
• Enzyme Commision number: 6.3.3.3: dethiobiotin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CTP	A	T11 G12 V13 G14 K15 T16 V17 E108 G111 G169 P197 G199 A200 A201	T12 G13 V14 G15 K16 T17 V18 E109 G112 G170 P198 G200 A201 A202	PDBbind-CN: -logKd/Ki=6.80,Kd=0.16uM
BS02	MG	A	T16 D49 E108	T17 D50 E109
BS03	DSD	A	T11 K37 T41 P71 A73 V115	T12 K38 T42 P72 A74 V116

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004141 dethiobiotin synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009102 biotin biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6cve, PDBe:6cve, PDBj:6cve
• PDBsum: 6cve
• UniProt: P9WPQ5|BIOD_MYCTU Dethiobiotin synthetase BioD (Gene Name=bioD)