Structure of PDB 6cus Chain A |
>6cusA (length=87) Species: 11888 (Rous sarcoma virus - Prague C) [Search protein sequence] |
SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGS WDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE |
|
PDB | 6cus Structural basis for targeting avian sarcoma virus Gag polyprotein to the plasma membrane for virus assembly. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IHP |
A |
K6 K13 K23 K24 |
K6 K13 K23 K24 |
PDBbind-CN: -logKd/Ki=4.89,Kd=0.013mM |
|
|