Structure of PDB 6ct5 Chain A

Receptor sequence

>6ct5A (length=221) Species: 1773 (Mycobacterium tuberculosis)

TLVASVLPEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHC
ARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAV
RSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEA
TYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLT
TLRGRWSVERGLVLTAIVLAG

3D structure

• PDB: 6ct5 Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.
• Chain: A
• Resolution: 1.75935 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	R48 R56 K75 K78 G79 E80 P81 L91 T92 H93 Y160 K161 F164	R40 R48 K67 K70 G71 E72 P73 L83 T84 H85 Y152 K153 F156
BS02	FD7	A	E157 Y160 W170 L171 G172 F173	E149 Y152 W162 L163 G164 F165	MOAD: ic50=2.5uM
BS03	FD7	A	V125 F153	V117 F145	MOAD: ic50=2.5uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Feb 22 12:13:55 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ct5', asym_id = 'A', title = 'Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ct5', asym_id='A', title='Opposing reactions in coenzyme A metabolism sensitizeMycobacterium tuberculosisto enzyme inhibition.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000287,0008897,0009239,0009366,0016780', uniprot = '', pdbid = '6ct5', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0008897,0009239,0009366,0016780', uniprot='', pdbid='6ct5', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>