Structure of PDB 6csl Chain A |
>6cslA (length=71) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] |
QGENISSLLRELYAKPLSERHVESDGLIFDPAQITSRTANGVAVPHGDHY HFIPYSQLSPLEEKLARIIPL |
|
PDB | 6csl Structural characterisation of the HT3 motif of the polyhistidine triad protein D from Streptococcus pneumoniae. |
Chain | A |
Resolution | 1.921 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D293 H314 H317 H319 |
D25 H46 H49 H51 |
|
|
|