Structure of PDB 6cro Chain A

Receptor sequence
>6croA (length=60) Species: 10710 (Lambdavirus lambda) [Search protein sequence]
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVY
AEEVKPFPSN
3D structure
PDB6cro Crystal structure of lambda-Cro bound to a consensus operator at 3.0 A resolution.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G15 Q16 V25 Y26 Q27 S28 N31 K32 H35 R38 G14 Q15 V24 Y25 Q26 S27 N30 K31 H34 R37
BS02 dna A G15 Q16 V25 Y26 Q27 S28 N31 K32 H35 R38 G14 Q15 V24 Y25 Q26 S27 N30 K31 H34 R37
Gene Ontology
Molecular Function
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0009411 response to UV
GO:0010944 negative regulation of transcription by competitive promoter binding
GO:0019042 viral latency
GO:0019046 release from viral latency
GO:0032897 negative regulation of viral transcription
GO:0098689 latency-replication decision

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6cro, PDBe:6cro, PDBj:6cro
PDBsum6cro
PubMed9653037
UniProtP03040|RCRO_LAMBD Regulatory protein cro (Gene Name=cro)

[Back to BioLiP]