Structure of PDB 6cq9 Chain A

Receptor sequence

>6cq9A (length=276) Species: 10090 (Mus musculus)

SDSAINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQR
EKFLRAHPCVSDQELDELIQQIVAAINAGSHWDLGSSFFFAGTVITTIGF
GNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDT
FIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALDAIYFV
VITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDW
LRVIAKKTKEAVGEFRAHAAEWTANV

3D structure

• PDB: 6cq9 K2P2.1 (TREK-1)-activator complexes reveal a cryptic selectivity filter binding site.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	K	A	I143 G144 F145 I252 G253	I98 G99 F100 I207 G208
BS02	K	A	G144 F145 G146 G253 F254 G255	G99 F100 G101 G208 F209 G210
BS03	Q5F	A	S131 F134 G137 T138 A259 G260 G261 K271 V274 W275 I278	S86 F89 G92 T93 A214 G215 G216 K226 V229 W230 I233
BS04	16C	A	Y57 A300 T303 K304	Y23 A255 T258 K259
BS05	K	A	T142 I143 G144 T251 I252 G253	T97 I98 G99 T206 I207 G208
BS06	K	A	T142 T251	T97 T206

Gene Ontology

Molecular Function

• GO:0005267 potassium channel activity

Biological Process

• GO:0071805 potassium ion transmembrane transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:6cq9, PDBe:6cq9, PDBj:6cq9
• PDBsum: 6cq9
• PubMed: 28693035
• UniProt: P97438|KCNK2_MOUSE Potassium channel subfamily K member 2 (Gene Name=Kcnk2)