Structure of PDB 6cpw Chain A

Receptor sequence
>6cpwA (length=328) Species: 10116 (Rattus norvegicus) [Search protein sequence]
VFDVRYTNLSYIGEGAYGMVCSAYDRVAIKKISPFEHQTYCQRTLREIKI
LLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSND
HICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVA
DPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSN
RPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVP
WNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPI
AEAPFLDDLPKEKLKELIFEETARFQPG
3D structure
PDB6cpw Discovery of 3(S)-thiomethyl pyrrolidine ERK inhibitors for oncology.
ChainA
Resolution1.85 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D147 K149 N152 D165 T188
Catalytic site (residue number reindexed from 1) D125 K127 N130 D143 T166
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F8V A I29 A33 Y34 A50 K52 Y62 T66 E69 D104 M106 E107 T108 L154 D165 I12 A16 Y17 A28 K30 Y40 T44 E47 D82 M84 E85 T86 L132 D143 MOAD: ic50=5.6nM
PDBbind-CN: -logKd/Ki=8.25,Kd=5.6nM
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0003690 double-stranded DNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008353 RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016301 kinase activity
GO:0019901 protein kinase binding
GO:0019902 phosphatase binding
GO:0031435 mitogen-activated protein kinase kinase kinase binding
GO:0042802 identical protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007166 cell surface receptor signaling pathway
GO:0007507 heart development
GO:0008284 positive regulation of cell population proliferation
GO:0008286 insulin receptor signaling pathway
GO:0009636 response to toxic substance
GO:0009887 animal organ morphogenesis
GO:0010759 positive regulation of macrophage chemotaxis
GO:0014032 neural crest cell development
GO:0014044 Schwann cell development
GO:0015966 diadenosine tetraphosphate biosynthetic process
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0018107 peptidyl-threonine phosphorylation
GO:0019233 sensory perception of pain
GO:0019858 cytosine metabolic process
GO:0030278 regulation of ossification
GO:0030335 positive regulation of cell migration
GO:0030521 androgen receptor signaling pathway
GO:0030641 regulation of cellular pH
GO:0030878 thyroid gland development
GO:0031647 regulation of protein stability
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0032355 response to estradiol
GO:0032496 response to lipopolysaccharide
GO:0032872 regulation of stress-activated MAPK cascade
GO:0033574 response to testosterone
GO:0033598 mammary gland epithelial cell proliferation
GO:0034198 cellular response to amino acid starvation
GO:0034614 cellular response to reactive oxygen species
GO:0035094 response to nicotine
GO:0035556 intracellular signal transduction
GO:0036120 cellular response to platelet-derived growth factor stimulus
GO:0038127 ERBB signaling pathway
GO:0038133 ERBB2-ERBB3 signaling pathway
GO:0042220 response to cocaine
GO:0042307 positive regulation of protein import into nucleus
GO:0042473 outer ear morphogenesis
GO:0042542 response to hydrogen peroxide
GO:0042552 myelination
GO:0043330 response to exogenous dsRNA
GO:0043401 steroid hormone receptor signaling pathway
GO:0043627 response to estrogen
GO:0044849 estrous cycle
GO:0045596 negative regulation of cell differentiation
GO:0045727 positive regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
GO:0046697 decidualization
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048538 thymus development
GO:0050847 progesterone receptor signaling pathway
GO:0050852 T cell receptor signaling pathway
GO:0050853 B cell receptor signaling pathway
GO:0051403 stress-activated MAPK cascade
GO:0051493 regulation of cytoskeleton organization
GO:0060020 Bergmann glial cell differentiation
GO:0060045 positive regulation of cardiac muscle cell proliferation
GO:0060291 long-term synaptic potentiation
GO:0060324 face development
GO:0060425 lung morphogenesis
GO:0060440 trachea formation
GO:0060716 labyrinthine layer blood vessel development
GO:0061308 cardiac neural crest cell development involved in heart development
GO:0061431 cellular response to methionine
GO:0070371 ERK1 and ERK2 cascade
GO:0070849 response to epidermal growth factor
GO:0071276 cellular response to cadmium ion
GO:0071320 cellular response to cAMP
GO:0071356 cellular response to tumor necrosis factor
GO:0071364 cellular response to epidermal growth factor stimulus
GO:0071380 cellular response to prostaglandin E stimulus
GO:0072584 caveolin-mediated endocytosis
GO:0090170 regulation of Golgi inheritance
GO:0097237 cellular response to toxic substance
GO:0097305 response to alcohol
GO:0120041 positive regulation of macrophage proliferation
GO:1904355 positive regulation of telomere capping
GO:1990314 cellular response to insulin-like growth factor stimulus
GO:2000641 regulation of early endosome to late endosome transport
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005901 caveola
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030424 axon
GO:0031143 pseudopodium
GO:0032839 dendrite cytoplasm
GO:0032991 protein-containing complex
GO:0043204 perikaryon
GO:0070161 anchoring junction
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cpw, PDBe:6cpw, PDBj:6cpw
PDBsum6cpw
PubMed29748051
UniProtP63086|MK01_RAT Mitogen-activated protein kinase 1 (Gene Name=Mapk1)

[Back to BioLiP]