Structure of PDB 6cko Chain A |
>6ckoA (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] |
ASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKN LTAKKERLQLLNAQLS |
|
PDB | 6cko Structural and functional analysis of the DOT1L-AF10 complex reveals mechanistic insights into MLL-AF10-associated leukemogenesis. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E737 H764 |
E8 H35 |
|
|
|