Structure of PDB 6ci5 Chain A

Receptor sequence

>6ci5A (length=189) Species: 1212546 (Anoxybacillus ayderensis G10)

GKILLLGPERKWLRDFLESFEDEVTQYQDKLDKKSAILNNVDFIISYGYR
YIIHPDIVERFKQRAINLHISYLPWNKGADPNLWSFLEDSPKGVTIHYID
SGLDTGEIIVQREVTYYENDTLRTTYERLTQTIEKLFMEYWPLIRLGKIR
GIPQPKGGSYHKLKDKEKYLYLLTDGWDTPVQKLIGKAQ

3D structure

• PDB: 6ci5 Structural Insight into a Novel Formyltransferase and Evolution to a Nonribosomal Peptide Synthetase Tailoring Domain.
• Chain: A
• Resolution: 2.00003 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F5G	A	G73 Y74 R75 N92 H94 P106 N107 L147 Y151 W202	G48 Y49 R50 N67 H69 P81 N82 L122 Y126 W177
BS02	1YJ	A	I78 N92 I124 D125 D129	I53 N67 I99 D100 D104

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 19:48:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ci5', asym_id = 'A', title = 'Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ci5', asym_id='A', title='Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009058', uniprot = '', pdbid = '6ci5', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009058', uniprot='', pdbid='6ci5', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>