Structure of PDB 6ci0 Chain A

Receptor sequence

>6ci0A (length=535) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

FTRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFMCAE
HLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIPALF
GGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGNGQL
GSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMR
APGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQP
SGGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPM
VYAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKIFSW
IATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDTYYV
VAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVGANL
TFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIF
YTLTRGARVTANNYWNEHADTLEWTLTSPPPEHTF

3D structure

PDB

6ci0 The K-path entrance in cytochrome c oxidase is defined by mutation of E101 and controlled by an adjacent ligand binding domain.

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H102 D132 W172 S200 S201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
Catalytic site (residue number reindexed from 1)	H86 D116 W156 S184 S185 H268 E270 Y272 S283 H317 H318 T343 K346 R465
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	DMU	A	F35 M443 S444	F19 M427 S428
BS02	DMU	A	P449 W451 F510 Y517	P433 W435 F494 Y501
BS03	DMU	A	W451 A506	W435 A490
BS04	DMU	A	M56 Q61 S83 F502	M40 Q45 S67 F486
BS05	DMU	A	W451 F516	W435 F500
BS06	CU	A	H284 H333 H334	H268 H317 H318
BS07	MG	A	H411 D412	H395 D396
BS08	CA	A	E54 A57 G59 Q61	E38 A41 G43 Q45
BS09	HEA	A	G38 T48 M51 R52 W95 I99 H102 M106 M107 V110 W172 Y414 F420 H421 M424 S425 M460 F468 R481 R482 S504	G22 T32 M35 R36 W79 I83 H86 M90 M91 V94 W156 Y398 F404 H405 M408 S409 M444 F452 R465 R466 S488
BS10	HEA	A	W280 V287 Y288 H333 H334 G360 G395 G398 I399 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W264 V271 Y272 H317 H318 G344 G379 G382 I383 L385 S386 D391 H395 V400 H403 F404 V407 M408 R465

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ci0, PDBe:6ci0, PDBj:6ci0
PDBsum	6ci0
PubMed	29626419
UniProt	P33517\|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)

[Back to BioLiP]