Structure of PDB 6cdb Chain A |
>6cdbA (length=97) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
SEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSN VSHQLKLLKSLHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK |
|
PDB | 6cdb Functional Role of Solvent Entropy and Conformational Entropy of Metal Binding in a Dynamically Driven Allosteric System. |
Chain | A |
Resolution | 1.99 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H97 H100 |
H92 H95 |
|
|
|
|