Structure of PDB 6c7s Chain A

Receptor sequence

>6c7sA (length=473) Species: 247156 (Nocardia farcinica IFM 10152)

MIDVIIAGGGPTGLMLAGELRLHGVRTVVLEKEPTPNQHSRSRGLHARSI
EVMDQRGLLERFLAHGEQFRVGGFFAGLAAEWPADLDTAHSYVLAIPQVV
TERLLTEHATELGAEIRRGCEVAGLDQDADGVTAELADGTRLRARYLVGC
DGGRSTVRRLLGVDFPGEPTRVETLLADVRIDVPVETLTAVVAEVRKTQL
RFGAVPAGDGFFRLIVPAQGLSADRAAPTLDELKRCLHATAGTDFGVHSP
RWLSRFGDATRLAERYRTGRVLLAGDAAHIHPPTGGQGLNLGIQDAFNLG
WKLAAAIGGWAPPDLLDSYHDERHPVAAEVLDNTRAQMTLLSLDPGPRAV
RRLMAELVEFPDVNRHLIEKITAIAVRYDLGDGHDLVGRRLRDIPLTEGR
LYERMRGGRGLLLDRTGRLSVSGWSDRVDHLADPGAALDVPAALLRPDGH
VAWVGEDQDDLLAHLPRWFGAAT

3D structure

• PDB: 6c7s Structural Evidence for Rifampicin Monooxygenase Inactivating Rifampicin by Cleaving Its Ansa-Bridge.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R43 A207 I215 P283
• Catalytic site (residue number reindexed from 1): R43 A207 I215 P283
• Enzyme Commision number: 1.14.13.211: rifampicin monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G8 G10 P11 T12 L30 E31 K32 R41 S42 Q98 E121 V122 D151 G152 T156 D276 P283 G286 G288 L289 N290	G8 G10 P11 T12 L30 E31 K32 R41 S42 Q98 E121 V122 D151 G152 T156 D276 P283 G286 G288 L289 N290
BS02	RFH	A	R43 G72 G73 F74 G77 A95 R196 L200 F202 G203 I215 F256 P283 T284 G285 G286	R43 G72 G73 F74 G77 A95 R196 L200 F202 G203 I215 F256 P283 T284 G285 G286

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0016491 oxidoreductase activity
• GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
• GO:0071949 FAD binding

External links

• PDB: RCSB:6c7s, PDBe:6c7s, PDBj:6c7s
• PDBsum: 6c7s
• PubMed: 29578336
• UniProt: Q5YTV5|ROX_NOCFA Rifampicin monooxygenase (Gene Name=rox)