Structure of PDB 6c24 Chain A

Receptor sequence
>6c24A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
LRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFI
FNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPI
THILVCRPKRTKASMSEFLESED
3D structure
PDB6c24 Structures of human PRC2 with its cofactors AEBP2 and JARID2.
ChainA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A F429 F432 T442 E443 A444 P451 W452 F4 F7 T17 E18 A19 P26 W27
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0031490 chromatin DNA binding
GO:0035064 methylated histone binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0106222 lncRNA binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0045596 negative regulation of cell differentiation
GO:0048709 oligodendrocyte differentiation
GO:0060816 random inactivation of X chromosome
GO:0140718 facultative heterochromatin formation
Cellular Component
GO:0001739 sex chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005677 chromatin silencing complex
GO:0005730 nucleolus
GO:0016586 RSC-type complex
GO:0016604 nuclear body
GO:0032993 protein-DNA complex
GO:0035098 ESC/E(Z) complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c24, PDBe:6c24, PDBj:6c24
PDBsum6c24
PubMed29348366
UniProtQ15022|SUZ12_HUMAN Polycomb protein SUZ12 (Gene Name=SUZ12)

[Back to BioLiP]