Structure of PDB 6bxu Chain A

Receptor sequence

>6bxuA (length=312) Species: 10090 (Mus musculus)

SANDNTPTFPEISYDVYVYTDMSPGDSVIQLTAVDADEGSNGEISYEILV
GGKGDFVINKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERRHSICT
VYTEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITY
AIENGDPQRVFNLSETTGILSLGKALDRESTDRYILIVTASDGRPDGTST
ATVNIVVTDVNDNAPVFDPYLPRNLSVVEEEANAFVGQVRATDPDAGING
QVHYSLGNFNNLFRITSNGSIYTAVKLNREARDHYELVVVATDGAVHPRH
STLTLYIKVLDI

3D structure

• PDB: 6bxu Structural determinants of protocadherin-15 mechanics and function in hearing and balance perception.
• Chain: A
• Resolution: 3.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	Q590 S591 P592 D621 E623 D671	Q111 S112 P113 D142 E144 D192
BS02	CA	A	E606 D656 E658 D691	E127 D177 E179 D212
BS03	CA	A	E606 E658 D688 V689 D691 D724	E127 E179 D209 V210 D212 D245
BS04	CA	A	N690 N692 D722 D724 N728 D772	N211 N213 D243 D245 N249 D293
BS05	CA	A	N482 N484 D514 D516 N520 D566	N3 N5 D35 D37 N41 D87

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

Biological Process

• GO:0007155 cell adhesion
• GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:6bxu, PDBe:6bxu, PDBj:6bxu
• PDBsum: 6bxu
• PubMed: 32963095
• UniProt: Q99PJ1|PCD15_MOUSE Protocadherin-15 (Gene Name=Pcdh15)