Structure of PDB 6bww Chain A

Receptor sequence

>6bwwA (length=463) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GKLPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVV
LCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRF
SLATMRDFMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNI
ICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKYFP
GTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSD
PSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEI
EQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFR
GYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALKRNEGFMP
HSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESGVG
NVPPSYQIRFLAR

3D structure

PDB

6bww Structure of cytochrome P450 2B4 with an acetate ligand and an active site hydrogen bond network similar to oxyferrous P450cam.

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	A	R98 W121 R125 A298 G299 T302 T303 I363 V367 H369 P428 H429 S430 R434 C436 L437 G438 A442	R71 W94 R98 A270 G271 T274 T275 I335 V339 H341 P400 H401 S402 R406 C408 L409 G410 A414
BS02	CM5	A	K186 F188 L198 F244 F296	K158 F160 L170 F216 F268
BS03	CM5	A	F365 P368 G476 V477	F337 P340 G448 V449
BS04	ACT	A	A298 T302	A270 T274
BS05	ACT	A	I468 P482	I440 P454
BS06	ACT	A	F184 F244 S248 K251	F156 F216 S220 K223
BS07	ACT	A	S96 G118 W121 T372	S69 G91 W94 T344
BS08	ACT	A	M137 R145	M109 R117
BS09	ACT	A	F244 Q247 S248 K251	F216 Q219 S220 K223
BS10	ACT	A	L129 R133	L102 R106

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0008392	arachidonate epoxygenase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0070330	aromatase activity

	Biological Process
GO:0006805	xenobiotic metabolic process
GO:0019373	epoxygenase P450 pathway

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6bww, PDBe:6bww, PDBj:6bww
PDBsum	6bww
PubMed	29730233
UniProt	P00178\|CP2B4_RABIT Cytochrome P450 2B4 (Gene Name=CYP2B4)

[Back to BioLiP]