Structure of PDB 6bw4 Chain A

Receptor sequence

>6bw4A (length=377) Species: 9606 (Homo sapiens) [Search protein sequence]

EAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVT
RPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNR
ARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKE
GYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAV
VEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCL
SFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHN
ETILASSGTDRRLNVWDLSKIGEEQSEDGPPELLFIHGGHTAKISDFSWN
PNEPWVICSVSEDNIMQVWQMAENIYN

3D structure

PDB

6bw4 Direct interaction between the PRDM3 and PRDM16 tumor suppressors and the NuRD chromatin remodeling complex.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E41 W42 H71 S73 E126 N128 E179 Y181 E231 D248 E395 N397	E37 W38 H67 S69 E97 N99 E150 Y152 E202 D219 E362 N364

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	protein binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0031492	nucleosomal DNA binding
GO:0042393	histone binding
GO:0042826	histone deacetylase binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006260	DNA replication
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0006335	DNA replication-dependent chromatin assembly
GO:0006338	chromatin remodeling
GO:0006355	regulation of DNA-templated transcription
GO:0007420	brain development
GO:0008285	negative regulation of cell population proliferation
GO:0030336	negative regulation of cell migration
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0042659	regulation of cell fate specification
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:1902455	negative regulation of stem cell population maintenance
GO:1902459	positive regulation of stem cell population maintenance
GO:2000736	regulation of stem cell differentiation

	Cellular Component
GO:0000118	histone deacetylase complex
GO:0000781	chromosome, telomeric region
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005829	cytosol
GO:0016581	NuRD complex
GO:0016589	NURF complex
GO:0032991	protein-containing complex
GO:0033186	CAF-1 complex
GO:0035098	ESC/E(Z) complex
GO:0070822	Sin3-type complex
GO:1904949	ATPase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6bw4, PDBe:6bw4, PDBj:6bw4
PDBsum	6bw4
PubMed	30462309
UniProt	Q09028\|RBBP4_HUMAN Histone-binding protein RBBP4 (Gene Name=RBBP4)

[Back to BioLiP]