Structure of PDB 6btm Chain A

Receptor sequence

>6btmA (length=221) Species: 376686 (Flavobacterium johnsoniae UW101) [Search protein sequence]

VLVTSIFLLLASGYFVYGYLMQVGVDQNYEPIQPIHYSHKIHAGDNEINC
KYCHSAARVSKTAGIPSLNVCMNCHKNISEVAETTATAEYSKAFYDAQIQ
KLYDAVGWDKTKQAYTGKTQPVKWVRIHNLPDFVYFNHSQHVSVAGVECQ
TCHGPVQEFEIMKQYSKLTMGWCVDCHRKTDVKMEGNAYYEKIHAELSKK
YGVEKLTAAQMGGLECGKCHY

3D structure

PDB

6btm Structure of the alternative complex III in a supercomplex with cytochrome oxidase.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	H259 Y260 S261 H265 I271 Y275 C294 C297 H298 V304 T308	H36 Y37 S38 H42 I48 Y52 C71 C74 H75 V81 T85
BS02	HEC	A	Q256 Y260 H262 H265 C273 C276 H277 W347 R349 I350 H351 C372 V379	Q33 Y37 H39 H42 C50 C53 H54 W124 R126 I127 H128 C149 V156
BS03	HEC	A	H277 A286 R349 H351 L353 F359 H361 H364 V370 C372 C375 H376	H54 A63 R126 H128 L130 F136 H138 H141 V147 C149 C152 H153
BS04	HEC	A	Q363 H364 W395 C396 C399 H400 T403 Y413 T430	Q140 H141 W172 C173 C176 H177 T180 Y190 T207
BS05	HEC	A	F356 M393 C396 L437 E438 C439 C442 H443	F133 M170 C173 L214 E215 C216 C219 H220

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

View graph for
Molecular Function

External links

PDB	RCSB:6btm, PDBe:6btm, PDBj:6btm
PDBsum	6btm
PubMed	29695868
UniProt	A5FJF1

[Back to BioLiP]