Structure of PDB 6btf Chain A

Receptor sequence

>6btfA (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]

LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSA
ARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQD
IVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQ
VVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLQPKD
QYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLAGEPLPVDSEKD
IFDYIQWKYREPKDRSE

3D structure

PDB

6btf I260Q DNA polymerase beta highlights precatalytic conformational rearrangements critical for fidelity.

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.7.7.7: DNA-directed DNA polymerase.
4.2.99.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	H34 S229 K230 G231 T233 K234 K280 R283 L287 T292 N294 E295 Y296	H24 S216 K217 G218 T220 K221 K267 R270 L274 T279 N281 E282 Y283
BS02	dna	A	S104 G105 G107 P108 S109 A110 R254 D256	S94 G95 G97 P98 S99 A100 R241 D243
BS03	dna	A	K35 A38 Y39 G64 G66 K68 I69	K25 A28 Y29 G54 G56 K58 I59
BS04	MG	A	D190 D192	D180 D182
BS05	DUP	A	R149 G179 S180 R183 S188 G189 D190 D192 Y271 T273 G274 D276 N279	R139 G169 S170 R173 S178 G179 D180 D182 Y258 T260 G261 D263 N266

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0016779	nucleotidyltransferase activity
GO:0016829	lyase activity
GO:0019899	enzyme binding
GO:0034061	DNA polymerase activity
GO:0046872	metal ion binding
GO:0051575	5'-deoxyribose-5-phosphate lyase activity
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity

	Biological Process
GO:0001701	in utero embryonic development
GO:0006259	DNA metabolic process
GO:0006260	DNA replication
GO:0006261	DNA-templated DNA replication
GO:0006281	DNA repair
GO:0006284	base-excision repair
GO:0006287	base-excision repair, gap-filling
GO:0006290	pyrimidine dimer repair
GO:0006297	nucleotide-excision repair, DNA gap filling
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0006915	apoptotic process
GO:0006954	inflammatory response
GO:0006974	DNA damage response
GO:0007435	salivary gland morphogenesis
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010332	response to gamma radiation
GO:0016445	somatic diversification of immunoglobulins
GO:0016446	somatic hypermutation of immunoglobulin genes
GO:0045471	response to ethanol
GO:0048535	lymph node development
GO:0048536	spleen development
GO:0048872	homeostasis of number of cells
GO:0051402	neuron apoptotic process
GO:0055093	response to hyperoxia
GO:0071707	immunoglobulin heavy chain V-D-J recombination
GO:0071897	DNA biosynthetic process

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005874	microtubule
GO:0005876	spindle microtubule
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6btf, PDBe:6btf, PDBj:6btf
PDBsum	6btf
PubMed	30239932
UniProt	P06746\|DPOLB_HUMAN DNA polymerase beta (Gene Name=POLB)

[Back to BioLiP]