Structure of PDB 6bt0 Chain A

Receptor sequence

>6bt0A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence]

QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQ
EYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGK
LLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKE
NQTAVDVFRRIILEAEKLE

3D structure

PDB

6bt0 A small molecule inhibitor of Rheb selectively targets mTORC1 signaling.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	S16 G18 K19 S20 S21 K120 D122 L123 S149 A150	S14 G16 K17 S18 S19 K118 D120 L121 S147 A148

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0019901	protein kinase binding
GO:0030295	protein kinase activator activity
GO:0043539	protein serine/threonine kinase activator activity
GO:0046872	metal ion binding

	Biological Process
GO:0007165	signal transduction
GO:0007264	small GTPase-mediated signal transduction
GO:0016241	regulation of macroautophagy
GO:0031669	cellular response to nutrient levels
GO:0032006	regulation of TOR signaling
GO:0032008	positive regulation of TOR signaling
GO:0048709	oligodendrocyte differentiation
GO:0048714	positive regulation of oligodendrocyte differentiation
GO:0051726	regulation of cell cycle
GO:0120163	negative regulation of cold-induced thermogenesis
GO:1904263	positive regulation of TORC1 signaling
GO:2000074	regulation of type B pancreatic cell development

	Cellular Component
GO:0000139	Golgi membrane
GO:0005681	spliceosomal complex
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0012505	endomembrane system
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0045202	synapse
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6bt0, PDBe:6bt0, PDBj:6bt0
PDBsum	6bt0
PubMed	29416044
UniProt	Q15382\|RHEB_HUMAN GTP-binding protein Rheb (Gene Name=RHEB)

[Back to BioLiP]