Structure of PDB 6bpt Chain A

Receptor sequence
>6bptA (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]
EVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFD
QYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKE
TLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSL
HLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
3D structure
PDB6bpt Cleavage of a carbon-fluorine bond by an engineered cysteine dioxygenase.
ChainA
Resolution2.402 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.13.11.20: cysteine dioxygenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE2 A H86 H88 H140 H82 H84 H136
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0016151 nickel cation binding
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0017172 cysteine dioxygenase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0000097 sulfur amino acid biosynthetic process
GO:0006534 cysteine metabolic process
GO:0006954 inflammatory response
GO:0007595 lactation
GO:0019448 L-cysteine catabolic process
GO:0033762 response to glucagon
GO:0042412 taurine biosynthetic process
GO:0043200 response to amino acid
GO:0045471 response to ethanol
GO:0051384 response to glucocorticoid
GO:0051591 response to cAMP
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bpt, PDBe:6bpt, PDBj:6bpt
PDBsum6bpt
PubMed29942080
UniProtQ16878|CDO1_HUMAN Cysteine dioxygenase type 1 (Gene Name=CDO1)

[Back to BioLiP]