Structure of PDB 6bjg Chain A

Receptor sequence
>6bjgA (length=143) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence]
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETD
NPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLG
ANQVGCHYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQL
3D structure
PDB6bjg Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.
ChainA
Resolution2.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R11 S38 W39 T40 K67 H111 S113 R115 S120 R11 S38 W39 T40 K63 H107 S109 R111 S116
BS02 rna A R18 W19 P37 W42 K60 Q107 V108 G109 S124 G126 R18 W19 P37 W42 K56 Q103 V104 G105 S120 G122
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bjg, PDBe:6bjg, PDBj:6bjg
PDBsum6bjg
PubMed31021526
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]