Structure of PDB 6bfk Chain A |
>6bfkA (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] |
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETF RNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIF GTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCG |
|
PDB | 6bfk Modifications to a common phosphorylation network provide individualized control in caspases. |
Chain | A |
Resolution | 1.753 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R64 H121 C163 |
R36 H93 C135 |
|
|
|
|