Structure of PDB 6bcr Chain A

Receptor sequence
>6bcrA (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS
3D structure
PDB6bcr Mechanism of IRSp53 inhibition by 14-3-3.
ChainA
Resolution1.986 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y19 K49 N50 G53 R56 S57 R60 K120 R127 Y128 L172 N173 V176 L220 N224 W228 Y19 K49 N50 G53 R56 S57 R60 K120 R127 Y128 L172 N173 V176 L220 N224 W228
BS02 MG A D81 E84 D81 E84
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0071889 14-3-3 protein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0034766 negative regulation of monoatomic ion transmembrane transport
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bcr, PDBe:6bcr, PDBj:6bcr
PDBsum6bcr
PubMed30696821
UniProtP27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)

[Back to BioLiP]