Structure of PDB 6bc8 Chain A

Receptor sequence
>6bc8A (length=205) Species: 9606 (Homo sapiens) [Search protein sequence]
TLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPV
QMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEI
TQPPLLSISSDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHT
REAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLY
VEERA
3D structure
PDB6bc8 Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
ChainA
Resolution1.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008432 JUN kinase binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001558 regulation of cell growth
GO:0002208 somatic diversification of immunoglobulins involved in immune response
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0007015 actin filament organization
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0010628 positive regulation of gene expression
GO:0010718 positive regulation of epithelial to mesenchymal transition
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0010944 negative regulation of transcription by competitive promoter binding
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0042177 negative regulation of protein catabolic process
GO:0042276 error-prone translesion synthesis
GO:0042772 DNA damage response, signal transduction resulting in transcription
GO:0043247 telomere maintenance in response to DNA damage
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045830 positive regulation of isotype switching
GO:0045893 positive regulation of DNA-templated transcription
GO:0051301 cell division
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:1901203 positive regulation of extracellular matrix assembly
GO:1904667 negative regulation of ubiquitin protein ligase activity
GO:2000042 negative regulation of double-strand break repair via homologous recombination
GO:2000048 negative regulation of cell-cell adhesion mediated by cadherin
GO:2000678 negative regulation of transcription regulatory region DNA binding
GO:2001034 positive regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0016035 zeta DNA polymerase complex
GO:0035861 site of double-strand break

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6bc8, PDBe:6bc8, PDBj:6bc8
PDBsum6bc8
PubMed30111544
UniProtQ9UI95|MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B (Gene Name=MAD2L2)

[Back to BioLiP]