Structure of PDB 6ba4 Chain A

Receptor sequence

>6ba4A (length=268) Species: 9606 (Homo sapiens)

KYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFH
LGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTL
YFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVSCIMILPPYQRR
GYGRFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSSVLLENLRDL
SIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQ
YKKPPITVDSVCLKWAPP

3D structure

• PDB: 6ba4 Inhibitors of histone acetyltransferases KAT6A/B induce senescence and arrest tumour growth.
• Chain: A
• Resolution: 1.949 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C540 C543 H556 C560	C34 C37 H50 C54
BS02	ACO	A	F600 L601 C646 I647 M648 I649 Q654 R655 G657 G659 R660 L683 S684 L686 S690 S693	F94 L95 C140 I141 M142 I143 Q148 R149 G151 G153 R154 L177 S178 L180 S184 S187
BS03	7L1	A	F600 L601 I647 M648 I649 Q654 R655 G657 G659 R660 L683 S684 L686 G687 S690 S693	F94 L95 I141 M142 I143 Q148 R149 G151 G153 R154 L177 S178 L180 G181 S184 S187

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6ba4, PDBe:6ba4, PDBj:6ba4
• PDBsum: 6ba4
• PubMed: 30069049
• UniProt: Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 (Gene Name=KAT8)