Structure of PDB 6b89 Chain A

Receptor sequence
>6b89A (length=234) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVG
IVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMA
VLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARA
LAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETL
AVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL
3D structure
PDB6b89 The Antibiotic Novobiocin Binds and Activates the ATPase That Powers Lipopolysaccharide Transport.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.5.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A Y13 R16 V18 N38 G39 G41 K42 T43 T44 Y12 R15 V17 N37 G38 G40 K41 T42 T43
BS02 MG A T43 Q85 T42 Q84
BS03 NOV A L72 H73 P84 A87 S88 V102 R150 L71 H72 P83 A86 S87 V101 R149
BS04 NOV A F90 R91 R92 L93 Q136 F89 R90 R91 L92 Q135
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0015920 lipopolysaccharide transport
GO:0043165 Gram-negative-bacterium-type cell outer membrane assembly
GO:0055085 transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:1990351 transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b89, PDBe:6b89, PDBj:6b89
PDBsum6b89
PubMed29135241
UniProtP0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB (Gene Name=lptB)

[Back to BioLiP]