Structure of PDB 6b64 Chain A

Receptor sequence

>6b64A (length=252) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MDERDALRISREIAGEVRKAIASMPLREAVKDVGMGKDGTPTKAADRVAE
DAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVS
LCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYC
NAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYD
AAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLEL
IK

3D structure

• PDB: 6b64 Osmolyte binding capacity of a dual action IMPase/FBPase (AF2372)
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.1.3.11: fructose-bisphosphatase.
  3.1.3.25: inositol-phosphate phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ASP	A	D85 G170 S171 A172 R191 D200	D85 G170 S171 A172 R191 D200
BS02	MG	A	E67 D82 L84 D85	E67 D82 L84 D85
BS03	MG	A	D82 D85 D200	D82 D85 D200
BS04	MG	A	D38 T40 P41 E67 E68	D38 T40 P41 E67 E68
BS05	ASP	A	K164 R165	K164 R165
BS06	ASP	A	R165 R167	R165 R167

Gene Ontology

Molecular Function

• GO:0008934 inositol monophosphate 1-phosphatase activity
• GO:0016787 hydrolase activity
• GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity
• GO:0046872 metal ion binding
• GO:0052832 inositol monophosphate 3-phosphatase activity
• GO:0052833 inositol monophosphate 4-phosphatase activity
• GO:0052834 inositol monophosphate phosphatase activity

Biological Process

• GO:0006020 inositol metabolic process
• GO:0007165 signal transduction
• GO:0046854 phosphatidylinositol phosphate biosynthetic process

External links

• PDB: RCSB:6b64, PDBe:6b64, PDBj:6b64
• PDBsum: 6b64
• UniProt: O30298|BSUHB_ARCFU Fructose-1,6-bisphosphatase/inositol-1-monophosphatase (Gene Name=suhB)