Structure of PDB 6b1u Chain A

Receptor sequence
>6b1uA (length=442) Species: 9606 (Homo sapiens) [Search protein sequence]
DGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDV
VGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICK
HGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIAD
FGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYAL
LCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRA
TIKDIREHEWFKQGLPSYLFPEDPSYDANVIDDEAVKEVCEKFESEVMNS
LYQDQLAVAYHLIIDNRRIMNQASEFYLASSPLKPHPERMPPLIKKAKWH
LGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKM
SLQLYLVDNRSYLLDFKSIDDPRLGSHTMDFFEMCASLITTL
3D structure
PDB6b1u Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
ChainA
Resolution2.77 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D139 K141 N144 D157 S176
Catalytic site (residue number reindexed from 1) D132 K134 N137 D150 S169
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
2.7.11.31: [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 STU A L22 G23 V24 G25 V30 A43 K45 E94 Y95 V96 G99 E100 E143 L146 L15 G16 V17 G18 V23 A36 K38 E87 Y88 V89 G92 E93 E136 L139
BS02 CG7 A V11 L18 G19 K29 K31 I46 D88 V4 L11 G12 K22 K24 I39 D81
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004679 AMP-activated protein kinase activity
GO:0004712 protein serine/threonine/tyrosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0047322 [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity
GO:0106310 protein serine kinase activity
GO:0140823 histone H2BS36 kinase activity
Biological Process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0006633 fatty acid biosynthetic process
GO:0006695 cholesterol biosynthetic process
GO:0006914 autophagy
GO:0007165 signal transduction
GO:0008610 lipid biosynthetic process
GO:0010468 regulation of gene expression
GO:0010508 positive regulation of autophagy
GO:0010629 negative regulation of gene expression
GO:0014850 response to muscle activity
GO:0016055 Wnt signaling pathway
GO:0016239 positive regulation of macroautophagy
GO:0016241 regulation of macroautophagy
GO:0016310 phosphorylation
GO:0031669 cellular response to nutrient levels
GO:0032007 negative regulation of TOR signaling
GO:0034599 cellular response to oxidative stress
GO:0042149 cellular response to glucose starvation
GO:0042593 glucose homeostasis
GO:0042752 regulation of circadian rhythm
GO:0043066 negative regulation of apoptotic process
GO:0045821 positive regulation of glycolytic process
GO:0048511 rhythmic process
GO:0055089 fatty acid homeostasis
GO:0062028 regulation of stress granule assembly
GO:0070507 regulation of microtubule cytoskeleton organization
GO:0071277 cellular response to calcium ion
GO:0071333 cellular response to glucose stimulus
GO:0071380 cellular response to prostaglandin E stimulus
GO:0071466 cellular response to xenobiotic stimulus
GO:0097009 energy homeostasis
GO:1903829 positive regulation of protein localization
GO:1903944 negative regulation of hepatocyte apoptotic process
GO:1904262 negative regulation of TORC1 signaling
GO:1904428 negative regulation of tubulin deacetylation
GO:1905691 lipid droplet disassembly
GO:1990044 protein localization to lipid droplet
GO:2000758 positive regulation of peptidyl-lysine acetylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0016607 nuclear speck
GO:0030424 axon
GO:0030425 dendrite
GO:0031588 nucleotide-activated protein kinase complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b1u, PDBe:6b1u, PDBj:6b1u
PDBsum6b1u
PubMed29657085
UniProtP54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 (Gene Name=PRKAA2)

[Back to BioLiP]