Structure of PDB 6b0b Chain A

Receptor sequence
>6b0bA (length=180) Species: 9606 (Homo sapiens) [Search protein sequence]
LLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKE
CHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHL
NLRIFASRLYYHWCKPQQDGLRLLCGSQVPVEVMGFPEFADCWENFVDHE
KPLSFNPYKMLEELDKNSRAIKRRLDRIKQ
3D structure
PDB6b0b The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
ChainA
Resolution3.28006 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A K16 R17 R18 W115 R179 K14 R15 R16 W113 R177
BS02 rna A Y24 R26 W82 W115 Y22 R24 W80 W113
BS03 ZN A H54 C85 C88 H52 C83 C86
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0010526 retrotransposon silencing
GO:0016554 cytidine to uridine editing
GO:0044355 clearance of foreign intracellular DNA
GO:0044828 negative regulation by host of viral genome replication
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b0b, PDBe:6b0b, PDBj:6b0b
PDBsum6b0b
PubMed29290613
UniProtQ6NTF7|ABC3H_HUMAN DNA dC->dU-editing enzyme APOBEC-3H (Gene Name=APOBEC3H)

[Back to BioLiP]