Structure of PDB 6azu Chain A

Receptor sequence

>6azuA (length=370) Species: 9606 (Homo sapiens) [Search protein sequence]

SKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEK
LNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPY
CQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSK
GFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKAL
QVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAG
GSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLE
SNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQG
TDLMNFLKTVRSTTEKSLLK

3D structure

PDB

6azu Immune-modulating enzyme indoleamine 2,3-dioxygenase is effectively inhibited by targeting its apo-form.

Chain

Resolution

2.822 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.13.11.52: indoleamine 2,3-dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F163 S167 F214 F226 A264 G265 S267 F270 M295 R343 H346 I349 I354 L384	F152 S156 F203 F215 A253 G254 S256 F259 M284 R332 H335 I338 I343 L353

Gene Ontology

	Molecular Function
GO:0004833	tryptophan 2,3-dioxygenase activity
GO:0009055	electron transfer activity
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0020037	heme binding
GO:0033754	indoleamine 2,3-dioxygenase activity
GO:0046872	metal ion binding
GO:0051213	dioxygenase activity

	Biological Process
GO:0002376	immune system process
GO:0002666	positive regulation of T cell tolerance induction
GO:0002678	positive regulation of chronic inflammatory response
GO:0002830	positive regulation of type 2 immune response
GO:0006569	tryptophan catabolic process
GO:0006954	inflammatory response
GO:0007565	female pregnancy
GO:0019441	tryptophan catabolic process to kynurenine
GO:0019805	quinolinate biosynthetic process
GO:0032496	response to lipopolysaccharide
GO:0032693	negative regulation of interleukin-10 production
GO:0032735	positive regulation of interleukin-12 production
GO:0033555	multicellular organismal response to stress
GO:0034276	kynurenic acid biosynthetic process
GO:0034354	'de novo' NAD biosynthetic process from tryptophan
GO:0036269	swimming behavior
GO:0042098	T cell proliferation
GO:0042130	negative regulation of T cell proliferation
GO:0043065	positive regulation of apoptotic process
GO:0046006	regulation of activated T cell proliferation
GO:0070233	negative regulation of T cell apoptotic process
GO:0070234	positive regulation of T cell apoptotic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030485	smooth muscle contractile fiber
GO:0032421	stereocilium bundle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6azu, PDBe:6azu, PDBj:6azu
PDBsum	6azu
PubMed	29531094
UniProt	P14902\|I23O1_HUMAN Indoleamine 2,3-dioxygenase 1 (Gene Name=IDO1)

[Back to BioLiP]