Structure of PDB 6ayu Chain A

Receptor sequence

>6ayuA (length=319) Species: 419947 (Mycobacterium tuberculosis H37Ra)

HMELVRVTEAGAMAAGRWVGRGDKEGGDGAAVDAMRELVNSVSMRGVVVI
GEGEKDHAPMLYNGEEVGNGDGPECDFAVDPIDGSTLMSKGMTNAISVLA
VADRGTMFDPSAVFYMNKIAVGPDAAHVLDITAPISENIRAVAKVKDLSV
RDMTVCILDRPRHAQLIHDVRATGARIRLITDGDVAGAISACRPHSGTDL
LAGIGGTPEGIIAAAAIRCMGGAIQAQLAPRDDAERRKALEAGYDLNQVL
TTEDLVSGENVFFCATGVTDGDLLKGVRYYPGGCTTHSIVMRSKSGTVRM
IEAYHRLSKLNEYSAIDFT

3D structure

• PDB: 6ayu Structures of the Mycobacterium tuberculosis GlpX protein (class II fructose-1,6-bisphosphatase): implications for the active oligomeric state, catalytic mechanism and citrate inhibition.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 3.1.3.11: fructose-bisphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F6P	A	D82 G83 Y114 R159 R161 D181 G182 D183 G205 E208	D83 G84 Y115 R160 R162 D182 G183 D184 G206 E209
BS02	MG	A	D79 D82 E208	D80 D83 E209
BS03	MLI	A	Y279 T284 H286 E301 T318	Y280 T285 H287 E302 T319
BS04	MG	A	A190 R192 S195 T197	A191 R193 S196 T198

Gene Ontology

Molecular Function

• GO:0016787 hydrolase activity
• GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006071 glycerol metabolic process
• GO:0006094 gluconeogenesis
• GO:0030388 fructose 1,6-bisphosphate metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6ayu, PDBe:6ayu, PDBj:6ayu
• PDBsum: 6ayu
• PubMed: 29652259
• UniProt: P9WN21|GLPX_MYCTU Fructose-1,6-bisphosphatase class 2 (Gene Name=glpX)