Structure of PDB 6ayr Chain A

Receptor sequence

>6ayrA (length=229) Species: 197 (Campylobacter jejuni)

GMKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKDHELVLAYSK
IGKVNSTLSASVMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYD
LDITAFGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGD
EFICDEAKKAKIREIFNADACEMEGASVALVCDALKVPCFILRAMSDKAG
EKAEFDFDEFVINSAKISANFVLKMCEKL

3D structure

• PDB: 6ayr Transition-State Analogues of Campylobacter jejuni 5'-Methylthioadenosine Nucleosidase.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 3.2.2.30: aminodeoxyfutalosine nucleosidase.
  3.2.2.9: adenosylhomocysteine nucleosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BIG	A	I50 V76 A77 G78 F151 I152 C170 E171 M172 E173 D196 F206	I51 V77 A78 G79 F152 I153 C171 E172 M173 E174 D197 F207	MOAD: Ki=4.1nM PDBbind-CN: -logKd/Ki=8.39,Ki=4.1nM
BS02	BIG	A	I102 F105	I103 F106	MOAD: Ki=4.1nM PDBbind-CN: -logKd/Ki=8.39,Ki=4.1nM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008782 adenosylhomocysteine nucleosidase activity
• GO:0008930 methylthioadenosine nucleosidase activity
• GO:0016787 hydrolase activity
• GO:0102246 6-amino-6-deoxyfutalosine hydrolase activity

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009234 menaquinone biosynthetic process
• GO:0019284 L-methionine salvage from S-adenosylmethionine
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6ayr, PDBe:6ayr, PDBj:6ayr
• PDBsum: 6ayr
• PubMed: 30339406
• UniProt: Q0PC20|MQMTN_CAMJE Aminodeoxyfutalosine nucleosidase (Gene Name=pfs)