Structure of PDB 6aso Chain A

Receptor sequence

>6asoA (length=369) Species: 4932 (Saccharomyces cerevisiae)

ANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKN
FRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYT
QRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLN
GLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRE
SFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRSLLGN
REISVSLADKKPFLERNEVKRLLASRNSKELETLICLFPLSDKVSPSLIC
QFLQEEIHINEKDIRKILLVSDFNGAIIIFRDSKFAAKMLMILNGSQFQG
KVIRSGTINDMKRYYNNQQ

3D structure

• PDB: 6aso Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
• Chain: A
• Resolution: 2.71 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N31 L34 T35 R38 W120 T122 N123 R148 S151 R153 F154 R158 R159 F160 Y162 Y186 S193 N194 P195 K198 R201 T202 T206 E211 M213 R215 N216 K239 N241 P243 Q246 F251 N252 N253 C255 F257 S283 D288 K289 K290 P291 F292 L293 R295 K299 N306	N2 L5 T6 R9 W91 T93 N94 R119 S122 R124 F125 R129 R130 F131 Y133 Y157 S164 N165 P166 K169 R172 T173 T177 E182 M184 R186 N187 K210 N212 P214 Q217 F222 N223 N224 C226 F228 S254 D259 K260 K261 P262 F263 L264 R266 K270 N277

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0017069 snRNA binding
• GO:0017070 U6 snRNA binding

Biological Process

• GO:0000244 spliceosomal tri-snRNP complex assembly
• GO:0000245 spliceosomal complex assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6aso, PDBe:6aso, PDBj:6aso
• PDBsum: 6aso
• PubMed: 29717126
• UniProt: P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 (Gene Name=PRP24)