Structure of PDB 6ar3 Chain A

Receptor sequence

>6ar3A (length=418) Species: 1422 (Geobacillus stearothermophilus)

ALLERILARDNLITALKRVEANQGAPGIDGVSTDQLRDYIRAHWSTIHAQ
LLAGTYRPAPVRRVEIPKPGGGTRQLGIPTVVDRLIQQAILQELTPIFDP
DFSSSSFGFRPGRNAHDAVRQAQGYIQEGYRYVVDMDLEKFFDRVNHDIL
MSRVARKVKDKRVLKLIRAYLQAGVMIEGVKVQTEEGTPQGGPLSPLLAN
ILLDDLDKELEKRGLKFCRYADDCNIYVKSLRAGQRVKQSIQRFLEKTLK
LKVNEEKSAVDRPWKRAFLGFSFTPERKARIRLAPRSIQRLKQRIRQLTN
PNWSISMPERIHRVNQYVMGWIGYFRLVETPSVLQTIEGWIRRRLRLCQW
LQWKRVRTRIRELRALGLKETAVMEIANTRKGAWRTTKTPQLHQALGKTY
WTAQGLKSLTQRYFELRQ

3D structure

• PDB: 6ar3 Structure of a Thermostable Group II Intron Reverse Transcriptase with Template-Primer and Its Functional and Evolutionary Implications.
• Chain: A
• Resolution: 3.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K18 Q24 Y221 L270 Q317 Y318 G321 W322 Y325	K17 Q23 Y220 L269 Q316 Y317 G320 W321 Y324
BS02	rna	A	R19 N23 G25 A26 R63 I67 L77 I79 R85 F110 R111 P112 G113 G192 P194 P197	R18 N22 G24 A25 R62 I66 L76 I78 R84 F109 R110 P111 G112 G191 P193 P196
BS03	rna	A	R281 S333	R280 S332
BS04	DTP	A	K69 R75 D138 L139 E140 K141 F142 F143 D223 K258	K68 R74 D137 L138 E139 K140 F141 F142 D222 K257
BS05	MG	A	D138 L139 D223	D137 L138 D222

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003964 RNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006278 RNA-templated DNA biosynthetic process
• GO:0006974 DNA damage response
• GO:0051607 defense response to virus

External links

• PDB: RCSB:6ar3, PDBe:6ar3, PDBj:6ar3
• PDBsum: 6ar3
• PubMed: 29153391
• UniProt: E2GM63