Structure of PDB 6ae3 Chain A

Receptor sequence
>6ae3A (length=348) Species: 10090 (Mus musculus) [Search protein sequence]
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIK
KVLQRFKNRELQIMRKLDHCNIVRLRYFFYSSGKKDEVYLNLVLDYVPET
VYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLL
LDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSI
DVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNY
TEKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSF
FDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAA
3D structure
PDB6ae3 Crystal structure of GSK3 beta in complex with the flavonoid, morin
ChainA
Resolution2.14 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D181 K183 N186 D200 S219
Catalytic site (residue number reindexed from 1) D143 K145 N148 D162 S181
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
2.7.11.26: [tau protein] kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MRI A G63 V70 K85 V110 D133 Y134 L188 G28 V35 K50 V73 D95 Y96 L150 MOAD: Kd=0.0000666M
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008013 beta-catenin binding
GO:0016301 kinase activity
GO:0019901 protein kinase binding
GO:0044024 histone H2AS1 kinase activity
GO:0050321 tau-protein kinase activity
GO:0070840 dynein complex binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000320 re-entry into mitotic cell cycle
GO:0001558 regulation of cell growth
GO:0001837 epithelial to mesenchymal transition
GO:0005977 glycogen metabolic process
GO:0006366 transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0006611 protein export from nucleus
GO:0006983 ER overload response
GO:0007010 cytoskeleton organization
GO:0007127 meiosis I
GO:0007399 nervous system development
GO:0007409 axonogenesis
GO:0007520 myoblast fusion
GO:0007623 circadian rhythm
GO:0008286 insulin receptor signaling pathway
GO:0009887 animal organ morphogenesis
GO:0009968 negative regulation of signal transduction
GO:0010508 positive regulation of autophagy
GO:0010614 negative regulation of cardiac muscle hypertrophy
GO:0010628 positive regulation of gene expression
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0010975 regulation of neuron projection development
GO:0010977 negative regulation of neuron projection development
GO:0014043 negative regulation of neuron maturation
GO:0014902 myotube differentiation
GO:0016055 Wnt signaling pathway
GO:0016310 phosphorylation
GO:0016477 cell migration
GO:0018105 peptidyl-serine phosphorylation
GO:0030154 cell differentiation
GO:0031175 neuron projection development
GO:0032007 negative regulation of TOR signaling
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032886 regulation of microtubule-based process
GO:0035372 protein localization to microtubule
GO:0035556 intracellular signal transduction
GO:0035729 cellular response to hepatocyte growth factor stimulus
GO:0036016 cellular response to interleukin-3
GO:0042752 regulation of circadian rhythm
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0045444 fat cell differentiation
GO:0045719 negative regulation of glycogen biosynthetic process
GO:0045724 positive regulation of cilium assembly
GO:0045773 positive regulation of axon extension
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046825 regulation of protein export from nucleus
GO:0046827 positive regulation of protein export from nucleus
GO:0048511 rhythmic process
GO:0048675 axon extension
GO:0048863 stem cell differentiation
GO:0051093 negative regulation of developmental process
GO:0051128 regulation of cellular component organization
GO:0060070 canonical Wnt signaling pathway
GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070885 negative regulation of calcineurin-NFAT signaling cascade
GO:0071385 cellular response to glucocorticoid stimulus
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:0097191 extrinsic apoptotic signaling pathway
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
GO:0141068 autosome genomic imprinting
GO:1900271 regulation of long-term synaptic potentiation
GO:1901030 positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:1903566 positive regulation of protein localization to cilium
GO:1904780 negative regulation of protein localization to centrosome
GO:2000727 positive regulation of cardiac muscle cell differentiation
GO:2000738 positive regulation of stem cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030426 growth cone
GO:0030877 beta-catenin destruction complex
GO:0043025 neuronal cell body
GO:0043198 dendritic shaft
GO:0048471 perinuclear region of cytoplasm
GO:0072687 meiotic spindle
GO:0098978 glutamatergic synapse
GO:1990904 ribonucleoprotein complex
GO:1990909 Wnt signalosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ae3, PDBe:6ae3, PDBj:6ae3
PDBsum6ae3
PubMed30197003
UniProtQ9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta (Gene Name=Gsk3b)

[Back to BioLiP]