Structure of PDB 6abl Chain A

Receptor sequence

>6ablA (length=267) Species: 1293038 (Methanosarcina mazei JCM 9314)

PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAE
ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQ
IFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKE
HLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDT
LDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNI
KRAARSGSYYNGISTNL

3D structure

• PDB: 6abl Structural Basis for Genetic-Code Expansion with Bulky Lysine Derivatives by an Engineered Pyrrolysyl-tRNA Synthetase.
• Chain: A
• Resolution: 1.47 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	E396 S399	E209 S212
BS02	ATP	A	R330 E332 H338 L339 F342 E396 L397 S398 S399 G421 G423 R426	R143 E145 H151 L152 F155 E209 L210 S211 S212 G234 G236 R239
BS03	9VL	A	M276 A302 A306 N346 C348 F384 S399 L407 D408 W411 I413 W417 G421	M89 A115 A119 N159 C161 F197 S212 L220 D221 W224 I226 W230 G234

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0005524 ATP binding

Biological Process

• GO:0043039 tRNA aminoacylation

External links

• PDB: RCSB:6abl, PDBe:6abl, PDBj:6abl
• PDBsum: 6abl
• PubMed: 31031143
• UniProt: Q8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)