Structure of PDB 6ab8 Chain A

Receptor sequence

>6ab8A (length=264) Species: 1293038 (Methanosarcina mazei JCM 9314)

PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAE
ERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNLSKQIFR
VDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLE
EFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDV
MHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRA
ARSGSYYNGISTNL

3D structure

• PDB: 6ab8 Structural Basis for Genetic-Code Expansion with Bulky Lysine Derivatives by an Engineered Pyrrolysyl-tRNA Synthetase.
• Chain: A
• Resolution: 1.753 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	E396 S399	E206 S209
BS02	ATP	A	R330 E332 H338 L339 F342 E396 L397 S398 S399 G421 G423 R426	R140 E142 H148 L149 F152 E206 L207 S208 S209 G231 G233 R236
BS03	9VC	A	A306 N346 F384 S399 D408 W417 G421	A116 N156 F194 S209 D218 W227 G231
BS04	9VC	A	M276 A302 N346 C348 F384 S399 D408 W411 W417	M89 A112 N156 C158 F194 S209 D218 W221 W227

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0005524 ATP binding

Biological Process

• GO:0043039 tRNA aminoacylation

External links

• PDB: RCSB:6ab8, PDBe:6ab8, PDBj:6ab8
• PDBsum: 6ab8
• PubMed: 31031143
• UniProt: Q8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)