Structure of PDB 6aaf Chain A

Receptor sequence
>6aafA (length=112) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
RSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLV
PSDLTVGQFVYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSE
DGFLYITYSGEN
3D structure
PDB6aaf Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
ChainA
Resolution2.197 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A F5 F9 E17 I21 Y25 R28 K46 K48 Y49 P52 Q59 Y62 V63 R67 F104 F4 F8 E16 I20 Y24 R27 K45 K47 Y48 P51 Q58 Y61 V62 R66 F103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0007033 vacuole organization
GO:0015031 protein transport
GO:0016236 macroautophagy
GO:0061025 membrane fusion
GO:0097352 autophagosome maturation
Cellular Component
GO:0000324 fungal-type vacuole
GO:0000329 fungal-type vacuole membrane
GO:0000407 phagophore assembly site
GO:0000421 autophagosome membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6aaf, PDBe:6aaf, PDBj:6aaf
PDBsum6aaf
PubMed30451685
UniProtO94272|ATG8_SCHPO Autophagy-related protein 8 (Gene Name=atg8)

[Back to BioLiP]