Structure of PDB 6a6t Chain A

Receptor sequence

>6a6tA (length=430) Species: 162425 (Aspergillus nidulans)

RANTKIIVVGGGGTMGSSTALHLLRAGYTPSNITVLDTYPIPSAQSAGYD
LNKIFGIGLRNKPDLQLYLEALDMWKNDPLFKPFFHNVGQMDVSSTEEGI
KKLRMRYQSLLDAGIGLEKTNFLLESEDEILAKAPHFTREQIKGWKGLFC
GDGGWLAAAKAINAIGQFLKEQGVKFGFGEAGTFKKPLFADADEKTCIGV
ETVDGTKYYADKVVLAAGAWSSTLVDLEEQCVSKAWVFAHIQLTPAEAAA
YKNTPVIYDGDYGFFIEPDENGIIKVCDEFPGFTHFKMHQPYGSPVPKLI
SVPRSHAKHPTDTYPHASEVTIKKAINRFLPRFNDKELFNRAMCWCTDTA
DANLLVCEHPRWKGFYLATGDSGHSFKLLPNIGKHVVELLEGRLESVFKD
AWRWRPGSGDALKSRRAAPAKDLADMPGWR

3D structure

• PDB: 6a6t Creation of haemoglobin A1c direct oxidase from fructosyl peptide oxidase by combined structure-based site specific mutagenesis and random mutagenesis.
• Chain: A
• Resolution: 1.901 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G13 G16 T17 M18 L39 D40 S46 Q48 S49 A50 K56 I57 G185 T186 F187 A220 G221 W223 L227 C347 C349 D374 G376 S378 F379 K380	G10 G13 T14 M15 L36 D37 S43 Q45 S46 A47 K53 I54 G182 T183 F184 A217 G218 W220 L224 C344 C346 D371 G373 S375 F376 K377

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 17:32:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6a6t', asym_id = 'A', title = 'Creation of haemoglobin A1c direct oxidase from ...ite specific mutagenesis and random mutagenesis. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6a6t', asym_id='A', title='Creation of haemoglobin A1c direct oxidase from ...ite specific mutagenesis and random mutagenesis. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491,0050660', uniprot = '', pdbid = '6a6t', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491,0050660', uniprot='', pdbid='6a6t', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>