Structure of PDB 6a5s Chain A

Receptor sequence
>6a5sA (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]
VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKTNEKKIEMVRAYREKIEKELEAVCQDVLSLLD
NYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYS
EAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS
3D structure
PDB6a5s YWHA/14-3-3 proteins recognize phosphorylated TFEB by a noncanonical mode for controlling TFEB cytoplasmic localization.
ChainA
Resolution2.099 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A N43 S46 K50 R57 R132 Y133 I171 L177 N178 E185 D214 D218 L225 N229 L232 W233 N42 S45 K49 R56 R127 Y128 I166 L172 N173 E180 D209 D213 L220 N224 L227 W228
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005080 protein kinase C binding
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0008426 protein kinase C inhibitor activity
GO:0019904 protein domain specific binding
GO:0030971 receptor tyrosine kinase binding
GO:0042802 identical protein binding
GO:0140031 phosphorylation-dependent protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0002842 positive regulation of T cell mediated immune response to tumor cell
GO:0006469 negative regulation of protein kinase activity
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0009966 regulation of signal transduction
GO:0022409 positive regulation of cell-cell adhesion
GO:0032869 cellular response to insulin stimulus
GO:0032880 regulation of protein localization
GO:0042149 cellular response to glucose starvation
GO:0045664 regulation of neuron differentiation
GO:0048167 regulation of synaptic plasticity
GO:0050870 positive regulation of T cell activation
GO:1904262 negative regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0031982 vesicle
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0098793 presynapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6a5s, PDBe:6a5s, PDBj:6a5s
PDBsum6a5s
PubMed30653408
UniProtP61981|1433G_HUMAN 14-3-3 protein gamma (Gene Name=YWHAG)

[Back to BioLiP]