Structure of PDB 6a5d Chain A |
>6a5dA (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
KKTCPVNFEFMNYTIITSKCKGPKYPPKECCGAFKDFACPYTDQLNDLSS DCATTMFSYINLYGKYPPGLFANQCKEGKEGLECPAGSQLPPE |
|
PDB | 6a5d Mechanisms of RALF peptide perception by a heterotypic receptor complex. |
Chain | A |
Resolution | 1.401 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FUC |
A |
V51 N52 M56 Y86 |
V6 N7 M11 Y41 |
|
|
|
|