Structure of PDB 6a58 Chain A

Receptor sequence

>6a58A (length=116) Species: 3702 (Arabidopsis thaliana)

EECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCGKNFFSHKYLVQHQ
RVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGARPYVCAEPDCGQTF
RFVSDFSRHKRKTGHS

3D structure

• PDB: 6a58 Crystal structures of REF6 and its complex with DNA reveal diverse recognition mechanisms.
• Chain: A
• Resolution: 1.57 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C1245 C1250 H1263 H1280	C8 C13 H26 H43
BS02	ZN	A	C1268 C1273 H1286 H1290	C31 C36 H49 H53
BS03	ZN	A	C1298 C1303 H1316 H1320	C61 C66 H79 H83
BS04	ZN	A	C1328 C1333 H1346 H1352	C91 C96 H109 H115

External links

• PDB: RCSB:6a58, PDBe:6a58, PDBj:6a58
• PDBsum: 6a58
• PubMed: 32257379
• UniProt: Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)